PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr027347.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 584aa    MW: 64973.2 Da    PI: 6.6146
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr027347.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.62e-1302135821373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA a+s++d+   ++l+++ +  +s +g+p+qRl ay++e+L ar   s+ ++y+al+++e +   s e l+++++++e++P+lkf++++a
  Pbr027347.1 213 LKQLLVACAGALSNNDMDGFEKLIEKARGAVSISGEPIQRLGAYLVEGLIARKEISGANIYHALRCREPE---SNELLSYMQILFEICPYLKFGYMAA 307
                  689*************************************************999**************9...99*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N aI ea  +e+r+HiiDf+i qG QW++LlqaLa+Rp+g+p++RiTg+++p+s+  + + le++g+rL+ + +++++p+ef+  v     +++ ++L
  Pbr027347.1 308 NGAIAEACRNEDRIHIIDFQIAQGSQWVTLLQALAARPGGAPHVRITGIDDPRSKhaRGDGLEAVGRRLKAISDKFNIPVEFHG-VPVFSPNVTRDML 404
                  ****************************************************9998999*************************.67788999***** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +v+pgEalaVn+ lqlh+++desv+ +++rd +L++v+sl+Pkv ++veqe+++n+++F++rf+ealeyy+a+f+s+++ +pr s+eri+vE+++l+r
  Pbr027347.1 405 DVRPGEALAVNFPLQLHHTPDESVDENNPRDGLLRTVRSLNPKVTTLVEQESNTNTTPFFNRFVEALEYYMAMFESIDVAMPRSSKERINVEQHCLAR 502
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +ivnv+aceg++r+erhe ++kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g+++lgWkdr+Lvs+SaW
  Pbr027347.1 503 DIVNVIACEGKQRVERHELFGKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYS-EHYTLVERDGAMLLGWKDRNLVSASAW 582
                  *************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.078187564IPR005202Transcription factor GRAS
PfamPF035146.9E-128213582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MDQHFGFGAT GAGFSYTAPL PTVPSLRKRL LGSLKFDTSN SPNSPFLTHF DSDSLTTLSD  60
SQEERSSSEN LSGVTPSCTS SFETNSYVHQ LRLSPSVDCS RDGLQVYSGS TSALKDANSN  120
QNIKQTLQEL ESALMGPDDE EEAVSTPNTY IGESSRRQMQ RSMSWIQEHQ VSQAVQRQTS  180
FVSRQRQLGE VQIEKRHKVI DDASLKGLPA GNLKQLLVAC AGALSNNDMD GFEKLIEKAR  240
GAVSISGEPI QRLGAYLVEG LIARKEISGA NIYHALRCRE PESNELLSYM QILFEICPYL  300
KFGYMAANGA IAEACRNEDR IHIIDFQIAQ GSQWVTLLQA LAARPGGAPH VRITGIDDPR  360
SKHARGDGLE AVGRRLKAIS DKFNIPVEFH GVPVFSPNVT RDMLDVRPGE ALAVNFPLQL  420
HHTPDESVDE NNPRDGLLRT VRSLNPKVTT LVEQESNTNT TPFFNRFVEA LEYYMAMFES  480
IDVAMPRSSK ERINVEQHCL ARDIVNVIAC EGKQRVERHE LFGKWKSRLT MAGFRQYPLS  540
SYVNSVIRSL LRCYSEHYTL VERDGAMLLG WKDRNLVSAS AWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-602155836375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355562.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM5X9Y90.0M5X9Y9_PRUPE; Uncharacterized protein
STRINGVIT_19s0014g04940.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-174GRAS family protein